PDB entry 3vi2

View 3vi2 on RCSB PDB site
Description: Crystal Structure Analysis of Plasmodium falciparum OMP Decarboxylase in complex with inhibitor HMOA
Class: lyase/lyase inhibitor
Keywords: Orotidine 5 f-monophosphate decarboxylase, LYASE-LYASE INHIBITOR complex
Deposited on 2011-09-16, released 2012-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ompdc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vi2a_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ompdc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vi2b_
  • Heterogens: HMZ, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vi2A (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vi2A (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vi2B (B:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vi2B (B:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailk