PDB entry 3vhw

View 3vhw on RCSB PDB site
Description: Crystal structure of the human vitamin D receptor ligand binding domain complexed with 4-MP
Class: transcription
Keywords: hormone receptor, transcription
Deposited on 2011-09-08, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VDR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vhwa_
  • Heterogens: VHW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vhwA (A:)
    gshmdslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsql
    smlphladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddm
    swtcgnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrp
    gvqdaalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrcl
    sfqpecsmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhwA (A:)
    dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndggsvtlelsqlsmlph
    ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
    nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
    alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
    csmkltplvlevfg