PDB entry 3vhv

View 3vhv on RCSB PDB site
Description: Mineralocorticoid receptor ligand-binding domain with non-steroidal antagonist
Class: transcription/inhibitor
Keywords: NUCLEAR RECEPTOR, TRANSCRIPTION FACTOR, ACTIVATING MUTATION, HYPERTENSION, NON-STEROIDAL ANTAGONIST, TRANSCRIPTION-INHIBITOR complex
Deposited on 2011-09-07, released 2011-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.142
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235 (2-259)
      • expression tag (0-1)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (251)
    Domains in SCOPe 2.06: d3vhva1, d3vhva2
  • Heterogens: LD1, LD2, EDO, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vhvA (A:)
    gslstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwa
    kvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsa
    myelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelr
    kmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveii
    sdqlpkvesgnvkplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhvA (A:)
    gslstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwa
    kvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsa
    myelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelr
    kmvtkgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlp
    kvesgnvkplyfhrk