PDB entry 3vhu

View 3vhu on RCSB PDB site
Description: Mineralocorticoid receptor ligand-binding domain with spironolactone
Class: transcription/inhibitor
Keywords: NUCLEAR RECEPTOR, TRANSCRIPTION FACTOR, ACTIVATING MUTATION, HYPERTENSION, ANTAGONIST, SPIRONOLACTONE, TRANSCRIPTION-INHIBITOR complex
Deposited on 2011-09-07, released 2011-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.193
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered mutation (117)
      • engineered mutation (119)
    Domains in SCOPe 2.06: d3vhua_
  • Heterogens: SNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vhuA (A:)
    mgsdkiihhhhhhenlyfqgsapakepsvntalvpqlstisraltpspvmvleniepeiv
    yagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitliqyswmsll
    sfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvrlqltfeeyt
    imkvllllstipkdglksqaafeemrtnyikelrkmvtkcpnnsgqswqrfyqltkllds
    mhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhuA (A:)
    stisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvl
    pgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamye
    lcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmv
    tgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkves
    gnakplyfh