PDB entry 3vhb

View 3vhb on RCSB PDB site
Description: imidazole adduct of the bacterial hemoglobin from vitreoscilla sp.
Class: oxygen storage/transport
Keywords: hemoprotein, oxygen transport
Deposited on 1999-03-17, released 1999-08-18
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.238
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemoglobin)
    Species: Vitreoscilla stercoraria
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3vhba_
  • Chain 'B':
    Compound: protein (hemoglobin)
    Species: Vitreoscilla stercoraria
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3vhbb_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vhbA (A:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
    vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
    awgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhbA (A:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
    lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
    dvfiqveadlyaqav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vhbB (B:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
    vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
    awgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
    lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
    dvfiqveadlyaqav