PDB entry 3vhb

View 3vhb on RCSB PDB site
Description: imidazole adduct of the bacterial hemoglobin from vitreoscilla sp.
Deposited on 1999-03-17, released 1999-08-18
The last revision prior to the SCOP 1.57 freeze date was dated 1999-08-18, with a file datestamp of 1999-08-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.238
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d3vhba_
  • Chain 'B':
    Domains in SCOP 1.57: d3vhbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vhbA (A:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
    laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
    wgkaygviadvfiqveadlyaqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhbA (A:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
    lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
    dvfiqveadlyaqav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
    laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
    wgkaygviadvfiqveadlyaqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
    lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
    dvfiqveadlyaqav