PDB entry 3vgo

View 3vgo on RCSB PDB site
Description: Crystal structure of the N-terminal fragment of Cbl-b
Class: ligase
Keywords: MEROHEDRAL TWINNING, E3 ligase, LIGASE
Deposited on 2011-08-18, released 2011-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.27
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase CBL-B
    Species: Homo sapiens [TaxId:9606]
    Gene: CBLB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vgoa1, d3vgoa2, d3vgoa3
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase CBL-B
    Species: Homo sapiens [TaxId:9606]
    Gene: CBLB
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase CBL-B
    Species: Homo sapiens [TaxId:9606]
    Gene: CBLB
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vgoA (A:)
    gphmgsaaadrrtvektwklmdkvvrlcqnpklqlknsppyildilpdtyqhlrlilsky
    ddnqklaqlseneyfkiyidslmkkskrairlfkegkermyeeqsqdrrnltklslifsh
    mlaeikaifpngqfqgdnfritkadaaefwrkffgdktivpwkvfrqclhevhqissgle
    amalkstidltcndyisvfefdiftrlfqpwgsilrnwnflavthpgymafltydevkar
    lqkystkpgsyifrlsctrlgqwaigyvtgdgnilqtiphnkplfqalidgsregfylyp
    dgrsynpdltglceptphdhikvtqeqyelycemgstfqlckicaendkdvkiepcghlm
    ctscltawqesdgqgcpfcrceikgtepiivdpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vgoA (A:)
    rrtvektwklmdkvvrlcqnpklqlknsppyildilpdtyqhlrlilskyaqlseneyfk
    iyidslmkkskrairlfkegkermyqdrrnltklslifshmlaeikaifpngqfqgdnfr
    itkadaaefwrkffgdktivpwkvfrqclhevhqissgleamalkstidltcndyisvfe
    fdiftrlfqpwgsilrnwnflavthpgymafltydevkarlqkystkpgsyifrlsctrl
    gqwaigyvtgdgnilqtiphnkplfqalidgsregfylypdgrsynp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.