PDB entry 3vga

View 3vga on RCSB PDB site
Description: Crystal structure of human adenosine A2A receptor with an allosteric inverse-agonist antibody at 3.1 A resolution
Class: signaling protein
Keywords: 7 transmembrane receptor, SIGNAL TRANSDUCTION, SIGNALING PROTEIN
Deposited on 2011-08-04, released 2012-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.199
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosine receptor A2a
    Species: Homo sapiens [TaxId:9606]
    Gene: ADORA2A, ADORA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VGA (0-End)
    Domains in SCOPe 2.07: d3vgab1, d3vgab2
  • Chain 'C':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VGA (0-End)
  • Heterogens: ZMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vgaB (B:)
    divmtqspaslsasvgdtvtitcrasefiyssltwyqqkqggspqllvyaatnladavps
    rfsgsgsgtqfslkinrlqpedfgtyycqhfygstwafgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vgaB (B:)
    divmtqspaslsasvgdtvtitcrasefiyssltwyqqkqggspqllvyaatnladavps
    rfsgsgsgtqfslkinrlqpedfgtyycqhfygstwafgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    No sequence available.