PDB entry 3vg9

View 3vg9 on RCSB PDB site
Description: Crystal structure of human adenosine A2A receptor with an allosteric inverse-agonist antibody at 2.7 A resolution
Class: signaling protein
Keywords: 7 transmembrane receptor, SIGNAL TRANSDUCTION, SIGNALING PROTEIN
Deposited on 2011-08-04, released 2012-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.208
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosine receptor A2a
    Species: Homo sapiens [TaxId:9606]
    Gene: ADORA2A, ADORA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VG9 (0-End)
    Domains in SCOPe 2.07: d3vg9b1, d3vg9b2
  • Chain 'C':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VG9 (0-225)
  • Heterogens: ZMA, STE, LMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vg9B (B:)
    divmtqspaslsasvgdtvtitcrasefiyssltwyqqkqggspqllvyaatnladavps
    rfsgsgsgtqfslkinrlqpedfgtyycqhfygstwafgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vg9B (B:)
    divmtqspaslsasvgdtvtitcrasefiyssltwyqqkqggspqllvyaatnladavps
    rfsgsgsgtqfslkinrlqpedfgtyycqhfygstwafgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    No sequence available.