PDB entry 3vg0

View 3vg0 on RCSB PDB site
Description: Antibody Fab fragment
Class: immune system
Keywords: Antibody Fab fragment, Immunoglobulin fold, N-linked Glycosylation site, Fab fragment, LBD domain of ObR receptor, IMMUNE SYSTEM
Deposited on 2012-01-10, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.194
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Monoclonal antibody 9F8 Fab fragment H chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VG0
  • Chain 'L':
    Compound: Monoclonal antibody 9F8 Fab fragment L chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VG0
    Domains in SCOPe 2.07: d3vg0l1, d3vg0l2
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3vg0L (L:)
    aeivmtqspkfmstsigdrvnitckatqnvrtavtwyqqkpgqspqaliflasnrhtgvp
    arftgsgsgtdftltinnvksedladyfclqhwnypltfgsgtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vg0L (L:)
    eivmtqspkfmstsigdrvnitckatqnvrtavtwyqqkpgqspqaliflasnrhtgvpa
    rftgsgsgtdftltinnvksedladyfclqhwnypltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne