PDB entry 3vfg

View 3vfg on RCSB PDB site
Description: Crystal structure of monoclonal antibody 3F8 Fab fragment that binds to GD2 ganglioside
Class: immune system
Keywords: Immunoglobulin, antibody, GD2 Ganglioside, IMMUNE SYSTEM
Deposited on 2012-01-09, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 3F8 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VFG (0-218)
  • Chain 'L':
    Compound: 3F8 Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VFG (0-210)
    Domains in SCOPe 2.07: d3vfgl1, d3vfgl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vfgL (L:)
    sivmtqtpkfllvsagdrvtitckasqsvsndvtwyqqkagqspklliysasnrysgvpd
    rftgsgygtaftftistvqaedlavyfcqqdyssfgggtkleikradaaptvsifppsse
    qltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltltk
    deyerhnsytceathktstspivksfnrnec