PDB entry 3vfc

View 3vfc on RCSB PDB site
Description: Crystal structure of enolase MSMEG_6132 (TARGET EFI-502282) from Mycobacterium smegmatis str. MC2 155 complexed with tartrate
Class: lyase
Keywords: enolase, magnesium binding site, lyase
Deposited on 2012-01-09, released 2012-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable glucarate dehydratase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_6132
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0R5B5 (22-444)
      • expression tag (21)
    Domains in SCOPe 2.06: d3vfca1, d3vfca2, d3vfca3
  • Heterogens: TLA, DTT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vfcA (A:)
    mhhhhhhssgvdlgtenlyfqsmahnriritgarvtpvafadppllntvgvhqpyalrav
    iqldtdagltglgetyadtvhlerlqaaahaivgrsvfstnviralisdalggdrtgdgs
    glagmitsasvvdrvfspfevacldvqgqvtgrpvsdllggavrdavpfsaylfykwaah
    pgaepdgwgaaldpdgivaqarrmideygfsaiklkggvfapeeemaavealraafpdhp
    lrldpnaawtpqtsvkvaaglegvleyledptpgldgmaevaaqapmplatnmcvvafdq
    lpaavaknsvqvvlsdhhywgglqrsrllagicdtfglglsmhsnshlgislaamvhlaa
    atpnltyacdthwpwrhedvvapgalnfcdgevqvpatpglgveidedalaalheqylrc
    girdrddtgymrsidpgfnasgprw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vfcA (A:)
    smahnriritgarvtpvafadppllntvgvhqpyalraviqldtdagltglgetyadtvh
    lerlqaaahaivgrsvfstnviralisdalggdragmitsasvvdrvfspfevacldvqg
    qvtgrpvsdllggavrdavpfsaylfykwaahpgaepdgwgaaldpdgivaqarrmidey
    gfsaiklkggvfapeeemaavealraafpdhplrldpnaawtpqtsvkvaaglegvleyl
    edptpgldgmaevaaqapmplatnmcvvafdqlpaavaknsvqvvlsdhhywgglqrsrl
    lagicdtfglglsmhsnshlgislaamvhlaaatpnltyacdthwpwrhedvvapgalnf
    cdgevqvpatpglgveidedalaalheqylrcgirdrddtgymrsidpgfnasgprw