PDB entry 3vf9

View 3vf9 on RCSB PDB site
Description: Crystal Structure of Spleen Tyrosine Kinase Syk Catalytic Domain with Thienopyrazolylindole Inhibitor 027
Class: transferase/transferase inhibitor
Keywords: kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-09, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vf9a_
  • Heterogens: 477, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vf9A (A:)
    mdtevyespyadpeeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavk
    ilkneandpalkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqq
    nrhvkdkniielvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalrad
    enyykaqthgkwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevt
    amlekgermgcpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vf9A (A:)
    yldrklltledkelgsgnfgtvkkgyyqmkvvktvavkilpalkdellaeanvmqqldnp
    yivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnf
    vhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykfs
    sksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwt
    ydvenrpgfaavelrlrnyyydvvn