PDB entry 3vdh

View 3vdh on RCSB PDB site
Description: Crystal structure of a putative beta-1,4-endoglucanase / cellulase from Prevotella bryantii
Class: Structural Genomics, Unknown Function
Keywords: PUTATIVE BETA-1,4-ENDOGLUCANASE, CELLULASE, GLYCOSYL HYDROLASE FAMILY 5, MIXED ALPHA-BETA, TIM BARREL, STRUCTURAL GENOMICS, PSI-Biology, PROTEIN STRUCTURE INITIATIVE, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, Unknown Function
Deposited on 2012-01-05, released 2012-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-1,4-endoglucanase
    Species: Prevotella bryantii [TaxId:77095]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vdha_
  • Chain 'B':
    Compound: B-1,4-endoglucanase
    Species: Prevotella bryantii [TaxId:77095]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vdhb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vdhA (A:)
    minqnatymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtf
    lmqngfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsg
    awikadtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgye
    alnnyaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsy
    dpwnffntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaeki
    klaadqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vdhA (A:)
    tymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqngf
    navripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawikad
    tdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnnya
    qdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnff
    ntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaadq
    aadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeayn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vdhB (B:)
    minqnatymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtf
    lmqngfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsg
    awikadtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgye
    alnnyaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsy
    dpwnffntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaeki
    klaadqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vdhB (B:)
    atymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqng
    fnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawika
    dtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnny
    aqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnf
    fntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaad
    qaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeayn