PDB entry 3vcn

View 3vcn on RCSB PDB site
Description: Crystal structure of mannonate dehydratase (target EFI-502209) from Caulobacter crescentus CB15
Class: lyase
Keywords: enolase, magnesium binding site, enzyme function initiative, efi, lyase
Deposited on 2012-01-04, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.132
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannonate dehydratase
    Species: Caulobacter crescentus [TaxId:155892]
    Gene: CC_0532, PRK15072
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vcna1, d3vcna2
  • Chain 'C':
    Compound: Mannonate dehydratase
    Species: Caulobacter crescentus [TaxId:155892]
    Gene: CC_0532, PRK15072
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vcnc1, d3vcnc2
  • Heterogens: MG, GOL, CO3, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vcnA (A:)
    mhhhhhhssgvdlgtenlyfqsmlkiidakvivtcpgrnfvtlkittedgitgvgdatln
    grelsvvsflqdhmvpsligrdahqiediwqffyrgsywrggpvamtalaavdmalwdik
    gkvaglpvyqllggacrtgvtvyghangetiedtiaeavkykamgykairlqtgvpglas
    tygvskdkmfyepadndlpteniwstakylnsvpklferarevlgwdvhllhdvhhrltp
    ieaarlgkdlepyrlfwledsvpaenqagfrlirqhtttplavgeifahvwdakqlieeq
    lidylratvlhaggitnlkkiaafadlhhvktgchgatdlspvtmaaalhfdmsitnfgl
    qeymrhtpetdavfphaytfsdgmlhpgdkpglgvdidedlaakhpykraylpvnrledg
    tmfnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vcnA (A:)
    mlkiidakvivtcpgrnfvtlkittedgitgvgdatlngrelsvvsflqdhmvpsligrd
    ahqiediwqffyrgsywrggpvamtalaavdmalwdikgkvaglpvyqllggacrtgvtv
    yghangetiedtiaeavkykamgykairlqtgvpglastygvskdkmfyepadndlpten
    iwstakylnsvpklferarevlgwdvhllhdvhhrltpieaarlgkdlepyrlfwledsv
    paenqagfrlirqhtttplavgeifahvwdakqlieeqlidylratvlhaggitnlkkia
    afadlhhvktgchgatdlspvtmaaalhfdmsitnfglqeymrhtpetdavfphaytfsd
    gmlhpgdkpglgvdidedlaakhpykraylpvnrledgtmfnw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vcnC (C:)
    mhhhhhhssgvdlgtenlyfqsmlkiidakvivtcpgrnfvtlkittedgitgvgdatln
    grelsvvsflqdhmvpsligrdahqiediwqffyrgsywrggpvamtalaavdmalwdik
    gkvaglpvyqllggacrtgvtvyghangetiedtiaeavkykamgykairlqtgvpglas
    tygvskdkmfyepadndlpteniwstakylnsvpklferarevlgwdvhllhdvhhrltp
    ieaarlgkdlepyrlfwledsvpaenqagfrlirqhtttplavgeifahvwdakqlieeq
    lidylratvlhaggitnlkkiaafadlhhvktgchgatdlspvtmaaalhfdmsitnfgl
    qeymrhtpetdavfphaytfsdgmlhpgdkpglgvdidedlaakhpykraylpvnrledg
    tmfnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vcnC (C:)
    mlkiidakvivtcpgrnfvtlkittedgitgvgdatlngrelsvvsflqdhmvpsligrd
    ahqiediwqffyrgsywrggpvamtalaavdmalwdikgkvaglpvyqllggacrtgvtv
    yghangetiedtiaeavkykamgykairlqtgvpglastygvskdkmfyepadndlpten
    iwstakylnsvpklferarevlgwdvhllhdvhhrltpieaarlgkdlepyrlfwledsv
    paenqagfrlirqhtttplavgeifahvwdakqlieeqlidylratvlhaggitnlkkia
    afadlhhvktgchgatdlspvtmaaalhfdmsitnfglqeymrhtpetdavfphaytfsd
    gmlhpgdkpglgvdidedlaakhpykraylpvnrledgtmfnw