PDB entry 3vck

View 3vck on RCSB PDB site
Description: Thaumatin by LB Hanging Drop Vapour Diffusion after 9.05 MGy X-Ray dose at ESRF ID29 beamline (Worst Case)
Class: plant protein
Keywords: radiation damage, thin film, Langmuir-Blodgett, LB, PLANT PROTEIN
Deposited on 2012-01-04, released 2012-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.168
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thaumatin I
  Species: Thaumatococcus daniellii [TaxId:4621]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RVT0 (0-206)
  Domains in SCOPe 2.08: d3vcka_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vckA (A:)
  atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
  sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
  crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
  fsyvldkpttvtcpgssnyrvtfcpta