PDB entry 3vb1

View 3vb1 on RCSB PDB site
Description: Crystal Structure of Anopholes gambiae odorant binding protein 20 in open state
Class: odorant-binding protein
Keywords: insect odorant binding protein, odor transport, possible odorant receptor, None, secreted lymph olfactory sensillum, ODORANT-BINDING PROTEIN
Deposited on 2011-12-30, released 2012-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agap005208-pa
    Species: Anopheles gambiae [TaxId:7165]
    Gene: OBP20, AgaP_AGAP005208
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Q9J3 (1-119)
      • expression tag (0)
    Domains in SCOPe 2.08: d3vb1a1, d3vb1a2
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vb1A (A:)
    mtveqmmksgemirsvclgktkvaeelvnglreskfadvkelkcyvncvmemmqtmkkgk
    lnydasvkqidtimpdelagpmraaldicrtvadgiknncdaayvllqclsknnpkfifp