PDB entry 3va8

View 3va8 on RCSB PDB site
Description: Crystal structure of enolase FG03645.1 (target EFI-502278) from Gibberella zeae PH-1 complexed with magnesium, formate and sulfate
Class: lyase
Keywords: enolase, magnesium binding site, lyase
Deposited on 2011-12-29, released 2012-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable dehydratase
    Species: Gibberella zeae [TaxId:5518]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VA8 (Start-444)
    Domains in SCOPe 2.07: d3va8a1, d3va8a2, d3va8a3
  • Heterogens: SO4, MG, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3va8A (A:)
    mhhhhhhssgvdlgtenlyfqsmsqrsiikeivitpvafhdmpllnsvgvhepfalrsii
    eiitedsyglgesygdsahldrlqkaadkikglsvystnviyqrcveslrndtntggdgm
    ggmvvtasvadkvfspfevacldlqgklagisvsdllggrvrdsvqysaylfykwgghpg
    deddeygpaldpegvvkqakkiideygfkaiklkggvfppadevaaikalhkafpgvplr
    ldpnaawtvetskwvakelegiveyledpageiegmaavakeasmplatnmavvafdhlp
    psilqdavqvilsdhhfwgglrksqtlasicatwglrlsmhsnshlgislaamthlasat
    pnldyacdthwpwkrrdedvviegalkwkdggvivpsgpglgveldrerlaklhqqyvdc
    glkkrddttymkrfkpefsekiprw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3va8A (A:)
    nlyfqsmsqrsiikeivitpvafhdmpllnsvgvhepfalrsiieiitedsyglgesygd
    sahldrlqkaadkikglsvystnviyqrcveslrndtngdgmggmvvtasvadkvfspfe
    vacldlqgklagisvsdllggrvrdsvqysaylfykwgghpgdeddeygpaldpegvvkq
    akkiideygfkaiklkggvfppadevaaikalhkafpgvplrldpnaawtvetskwvake
    legiveyledpageiegmaavakeasmplatnmavvafdhlppsilqdavqvilsdhhfw
    gglrksqtlasicatwglrlsmhsnshlgislaamthlasatpnldyacdthwpwkrrde
    dvviegalkwkdggvivpsgpglgveldrerlaklhqqyvdcglkkrddttymkrfkpef
    sekiprw