PDB entry 3v9t

View 3v9t on RCSB PDB site
Description: Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative modulator
Class: transcription/transcription regulator
Keywords: three-layered alpha-helical sandwich, transcription regulation, TRANSCRIPTION-TRANSCRIPTION REGULATOR complex
Deposited on 2011-12-28, released 2012-02-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.203
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3v9ta_
  • Chain 'C':
    Compound: Peptide from Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 17L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v9tA (A:)
    mrgshhhhhhgpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmns
    lmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndq
    vtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkf
    nalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfak
    llqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9tA (A:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkiske
    vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
    dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
    rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
    kktetslhpllqeiykdl
    

  • Chain 'C':
    No sequence available.