PDB entry 3v9j

View 3v9j on RCSB PDB site
Description: Crystal structure of mouse 1-pyrroline-5-carboxylate dehydrogenase complexed with sulfate ion
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, Rossmann fold, nucleotide binding, acting on aldehyde or oxo group of donors, NAD or NADP as acceptor, mitochondria, OXIDOREDUCTASE
Deposited on 2011-12-27, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.133
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: Aldh4a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CHT0 (21-562)
      • expression tag (19-20)
      • conflict (32)
      • conflict (60)
      • conflict (467)
    Domains in SCOPe 2.07: d3v9ja1, d3v9ja2
  • Chain 'B':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: Aldh4a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CHT0 (21-562)
      • expression tag (17-20)
      • conflict (32)
      • conflict (60)
      • conflict (467)
    Domains in SCOPe 2.07: d3v9jb1, d3v9jb2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v9jA (A:)
    mgsshhhhhhssglvprgshmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgq
    teaipcvvgdeevwtsdiqyqlspfnhahkvakfcyadkallnraidaalaarkewdlkp
    madraqvflkaadmlsgprraevlaktmvgqgktviqaeidaaaelidffrfnakfavel
    egeqpisvppstnhtvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtaml
    asyavyrilreaglppniiqfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaq
    nldrfrtfprlagecggknfhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpksl
    wpqikgrlleehsrikvgdpaedfgtffsavidakafarikkwleharsspslsilaggq
    cnesvgyyvepciieskdpqepimkeeifgpvltvyvypddkyretlklvdsttsygltg
    avfaqdkaivqeatrmlrnaagnfyindkstgsvvgqqpfggarasgtndkpggphyilr
    wtspqvikethkplgdwrysymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9jA (A:)
    hmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiq
    yqlspfnhahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgpr
    raevlaktmvgqgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrg
    legfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppnii
    qfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecggkn
    fhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikvgd
    paedfgtffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdp
    qepimkeeifgpvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrn
    aagnfyindkstgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwry
    symq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v9jB (B:)
    mgsshhhhhhssglvprgshmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgq
    teaipcvvgdeevwtsdiqyqlspfnhahkvakfcyadkallnraidaalaarkewdlkp
    madraqvflkaadmlsgprraevlaktmvgqgktviqaeidaaaelidffrfnakfavel
    egeqpisvppstnhtvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtaml
    asyavyrilreaglppniiqfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaq
    nldrfrtfprlagecggknfhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpksl
    wpqikgrlleehsrikvgdpaedfgtffsavidakafarikkwleharsspslsilaggq
    cnesvgyyvepciieskdpqepimkeeifgpvltvyvypddkyretlklvdsttsygltg
    avfaqdkaivqeatrmlrnaagnfyindkstgsvvgqqpfggarasgtndkpggphyilr
    wtspqvikethkplgdwrysymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9jB (B:)
    gshmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsd
    iqyqlspfnhahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsg
    prraevlaktmvgqgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvy
    rglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppn
    iiqfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecgg
    knfhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikv
    gdpaedfgtffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciiesk
    dpqepimkeeifgpvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrml
    rnaagnfyindkstgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdw
    rysymq