PDB entry 3v9g

View 3v9g on RCSB PDB site
Description: Crystal structure of human 1-pyrroline-5-carboxylate dehydrogenase
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, Rossmann fold, nucleotide binding, acting on aldehyde or oxo group of donors, NAD or NADP as acceptor, mitochondria, OXIDOREDUCTASE
Deposited on 2011-12-27, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH4, ALDH4A1, P5CDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v9ga_
  • Chain 'B':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH4, ALDH4A1, P5CDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v9gb_
  • Chain 'C':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH4, ALDH4A1, P5CDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v9gc_
  • Chain 'D':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH4, ALDH4A1, P5CDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v9gd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v9gA (A:)
    mgsshhhhhhssglvprgshtgaglrwkhtsslkvanepvlaftqgsperdalqkalkdl
    kgrmeaipcvvgdeevwtsdvqyqvspfnhghkvakfcyadksllnkaieaalaarkewd
    lkpiadraqiflkaadmlsgprraeilaktmvgqgktviqaeidaaaelidffrfnakya
    velegqqpisvppstnstvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdt
    amlasyavyrilreaglppniiqfvpadgplfgdtvtssehlcginftgsvptfkhlwkq
    vaqnldrfhtfprlagecggknfhfvhrsadvesvvsgtlrsafeyggqkcsacsrlyvp
    hslwpqikgrlleehsrikvgdpaedfgtffsavidaksfarikkwleharsspsltila
    ggkcddsvgyfvepciveskdpqepimkeeifgpvlsvyvypddkyketlqlvdsttsyg
    ltgavfsqdkdvvqeatkvlrnaagnfyindkstgsivgqqpfggarasgtndkpggphy
    ilrwtspqvikethkplgdwsyaymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9gA (A:)
    rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
    spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
    ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
    fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
    padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
    vhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpae
    dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
    imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
    nfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwsyaym
    q
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v9gB (B:)
    mgsshhhhhhssglvprgshtgaglrwkhtsslkvanepvlaftqgsperdalqkalkdl
    kgrmeaipcvvgdeevwtsdvqyqvspfnhghkvakfcyadksllnkaieaalaarkewd
    lkpiadraqiflkaadmlsgprraeilaktmvgqgktviqaeidaaaelidffrfnakya
    velegqqpisvppstnstvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdt
    amlasyavyrilreaglppniiqfvpadgplfgdtvtssehlcginftgsvptfkhlwkq
    vaqnldrfhtfprlagecggknfhfvhrsadvesvvsgtlrsafeyggqkcsacsrlyvp
    hslwpqikgrlleehsrikvgdpaedfgtffsavidaksfarikkwleharsspsltila
    ggkcddsvgyfvepciveskdpqepimkeeifgpvlsvyvypddkyketlqlvdsttsyg
    ltgavfsqdkdvvqeatkvlrnaagnfyindkstgsivgqqpfggarasgtndkpggphy
    ilrwtspqvikethkplgdwsyaymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9gB (B:)
    rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
    spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
    ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
    fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
    padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
    vhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpae
    dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
    imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
    nfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwsyaym
    q
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3v9gC (C:)
    mgsshhhhhhssglvprgshtgaglrwkhtsslkvanepvlaftqgsperdalqkalkdl
    kgrmeaipcvvgdeevwtsdvqyqvspfnhghkvakfcyadksllnkaieaalaarkewd
    lkpiadraqiflkaadmlsgprraeilaktmvgqgktviqaeidaaaelidffrfnakya
    velegqqpisvppstnstvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdt
    amlasyavyrilreaglppniiqfvpadgplfgdtvtssehlcginftgsvptfkhlwkq
    vaqnldrfhtfprlagecggknfhfvhrsadvesvvsgtlrsafeyggqkcsacsrlyvp
    hslwpqikgrlleehsrikvgdpaedfgtffsavidaksfarikkwleharsspsltila
    ggkcddsvgyfvepciveskdpqepimkeeifgpvlsvyvypddkyketlqlvdsttsyg
    ltgavfsqdkdvvqeatkvlrnaagnfyindkstgsivgqqpfggarasgtndkpggphy
    ilrwtspqvikethkplgdwsyaymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9gC (C:)
    rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
    spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
    ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
    fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
    padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
    vhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpae
    dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
    imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
    nfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwsyaym
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3v9gD (D:)
    mgsshhhhhhssglvprgshtgaglrwkhtsslkvanepvlaftqgsperdalqkalkdl
    kgrmeaipcvvgdeevwtsdvqyqvspfnhghkvakfcyadksllnkaieaalaarkewd
    lkpiadraqiflkaadmlsgprraeilaktmvgqgktviqaeidaaaelidffrfnakya
    velegqqpisvppstnstvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdt
    amlasyavyrilreaglppniiqfvpadgplfgdtvtssehlcginftgsvptfkhlwkq
    vaqnldrfhtfprlagecggknfhfvhrsadvesvvsgtlrsafeyggqkcsacsrlyvp
    hslwpqikgrlleehsrikvgdpaedfgtffsavidaksfarikkwleharsspsltila
    ggkcddsvgyfvepciveskdpqepimkeeifgpvlsvyvypddkyketlqlvdsttsyg
    ltgavfsqdkdvvqeatkvlrnaagnfyindkstgsivgqqpfggarasgtndkpggphy
    ilrwtspqvikethkplgdwsyaymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9gD (D:)
    rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
    spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
    ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
    fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
    padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
    vhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpae
    dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
    imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
    nfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwsyaym