PDB entry 3v9a

View 3v9a on RCSB PDB site
Description: Crystal structure of Esterase/Lipase from uncultured bacterium
Class: hydrolase activator
Keywords: esterase, lipase, HYDROLASE ACTIVATOR
Deposited on 2011-12-24, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase/lipase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: estE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v9aa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v9aA (A:)
    magpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqveqvtvagcaaewvr
    apgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyrlapehpfpaaved
    gvaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpasaipispwadmtct
    ndsfktraeadpmvapgginkmaarylngadakhpyaspnfanlkglppllihvgrdevl
    lddsikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrvgefmreqwaalaa
    alehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9aA (A:)
    agpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqveqvtvagcaaewvra
    pgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyrlapehpfpaavedg
    vaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpasaipispwadmtctn
    dsfktraeadpmgginkmaarylngadakhpyaspnfanlkglppllihvgrdevlldds
    ikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrvgefmreqwaa