PDB entry 3v7m

View 3v7m on RCSB PDB site
Description: Crystal structure of monoclonal human anti-Rhesus D Fc IgG1 T125(YB2/0) in the presence of Zn2+
Class: immune system
Keywords: FC IGG1, FC-GAMMA receptor, IMMUNE SYSTEM
Deposited on 2011-12-21, released 2012-02-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.237
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3v7ma1, d3v7ma2
  • Heterogens: ZN, IMD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3v7mA (A:)
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
rwqqgnvfscsvmhealhnhytqkslsls