PDB entry 3v6e

View 3v6e on RCSB PDB site
Description: Crystal Structure of USP2 and a mutant form of Ubiquitin
Class: hydrolase/signaling protein
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, ubiquitin, protease, hydrolase-signaling protein complex
Deposited on 2011-12-19, released 2012-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.177
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBP41, usp02.258.605, USP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3v6ea_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (14-90)
      • expression tag (10-13)
      • engineered mutation (16)
      • engineered mutation (22)
      • engineered mutation (25)
      • engineered mutation (28)
    Domains in SCOPe 2.06: d3v6eb1, d3v6eb2
  • Heterogens: ZN, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v6eA (A:)
    mgsshhhhhhssglvprgsmnsksaqglaglrnlgntcfmnsilqclsntrelrdyclqr
    lymrdlhhgsnahtalveefakliqtiwtsspndvvspsefktqiqryaprfvgynqqda
    qeflrflldglhnevnrvtlrpksnpenldhlpddekgrqmwrkyleredsrigdlfvgq
    lkssltctdcgycstvfdpfwdlslpiakrgypevtlmdcmrlftkedvldgdekptccr
    crgrkrcikkfsiqrfpkilvlhlkrfsesrirtsklttfvnfplrdldlrefasentnh
    avynlyavsnhsgttmgghytaycrspgtgewhtfndssvtpmsssqvrtsdayllfyel
    asppsrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v6eA (A:)
    aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
    qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpkp
    enldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlslp
    iakevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlkrfses
    tsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycrspgtgewh
    tfndssvtpmsssqvrtsdayllfyela
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v6eB (B:)
    mahhhhhhssglvprgsmqifvntlsgkhitlevepsdtienvkakiqdkegippdqqrl
    ifagkqledgrtlsdyniqkestlhlvlrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v6eB (B:)
    glvprgsmqifvntlsgkhitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlr