PDB entry 3v4v

View 3v4v on RCSB PDB site
Description: crystal structure of a4b7 headpiece complexed with Fab ACT-1 and RO0505376
Class: cell adhesion
Keywords: Cell Adhesion, MAdCAM-1, Membrane
Deposited on 2011-12-15, released 2012-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.198
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA4, CD49D
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Integrin beta-7
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB7
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Integrin alpha-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA4, CD49D
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Integrin beta-7
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB7
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: MONOCLONAL ANTIBODY Act-1 HEAVY CHAIN
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V4V (0-End)
  • Chain 'L':
    Compound: MONOCLONAL ANTIBODY Act-1 LIGHT CHAIN
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V4V (0-216)
    Domains in SCOPe 2.06: d3v4vl1, d3v4vl2
  • Chain 'M':
    Compound: MONOCLONAL ANTIBODY Act-1 HEAVY CHAIN
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V4V (0-218)
  • Chain 'N':
    Compound: MONOCLONAL ANTIBODY Act-1 LIGHT CHAIN
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V4V (0-216)
    Domains in SCOPe 2.06: d3v4vn1, d3v4vn2
  • Heterogens: CA, NAG, TRS, MG, 0DU, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v4vL (L:)
    dvvvtqtplslpvsfgdqvsiscrssqslaksygntylswylhkpgqspqlliygisnrf
    sgvpdrfsgsgsgtdftlkistikpedlgmyyclqgthqpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwnidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v4vN (N:)
    dvvvtqtplslpvsfgdqvsiscrssqslaksygntylswylhkpgqspqlliygisnrf
    sgvpdrfsgsgsgtdftlkistikpedlgmyyclqgthqpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwnidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn