PDB entry 3v4b

View 3v4b on RCSB PDB site
Description: Crystal structure of an enolase from the soil bacterium Cellvibrio japonicus (TARGET EFI-502161) with bound MG and L-tartrate
Class: lyase
Keywords: Enolase, enzyme function initiative, EFI, LYASE
Deposited on 2011-12-14, released 2011-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.149
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Starvation sensing protein rspA
    Species: Cellvibrio japonicus [TaxId:498211]
    Gene: rspA, CJA_3069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3v4ba1, d3v4ba2
  • Heterogens: MG, CL, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v4bA (A:)
    mhhhhhhssgvdlgtenlyfqsmkivdakvivtcpgrnfvtlkivtdqgiygigdatlng
    reksvvsyledylipvligrdpqqiediwqffyrgaywrrgpvgmtalaaidvalwdika
    klanmplyqllggksrerilsythangkdldstleavrkakdkgykairvqcgipgiakt
    ygvstntksyepadadlpsvevwstekylnyipdvfaavrkefgpdihllhdvhhrltpi
    eaarlgkalepyhlfwmedavpaenqesfklirqhtttplavgevfnsihdcreliqnqw
    idyirttivhaggisqmrriadfaslfhvrtgfhgatdlspvcmgaalhfdywvpnfgiq
    ehmahseqmnavfphaytfndgyftpgekpghgvdideklaaqypykraclpvnrledgt
    lwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v4bA (A:)
    mkivdakvivtcpgrnfvtlkivtdqgiygigdatlngreksvvsyledylipvligrdp
    qqiediwqffyrgaywrrgpvgmtalaaidvalwdikaklanmplyqllggksrerilsy
    thangkdldstleavrkakdkgykairvqcgipgidlpsvevwstekylnyipdvfaavr
    kefgpdihllhdvhhrltpieaarlgkalepyhlfwmedavpaenqesfklirqhtttpl
    avgevfnsihdcreliqnqwidyirttivhaggisqmrriadfaslfhvrtgfhgatdls
    pvcmgaalhfdywvpnfgiqehmahseqmnavfphaytfndgyftpgekpghgvdidekl
    aaqypykraclpvnrledgtlwhw