PDB entry 3v3y

View 3v3y on RCSB PDB site
Description: Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV
Class: electron transport
Keywords: Photosynthetic reaction center, Primary electron donor, membrane, ELECTRON TRANSPORT
Deposited on 2011-12-14, released 2012-03-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.246
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: puhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3v3yh1, d3v3yh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0Y8 (0-280)
      • see remark 999 (177)
    Domains in SCOPe 2.05: d3v3yl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0Y9 (0-301)
      • see remark 999 (7)
    Domains in SCOPe 2.05: d3v3ym_
  • Heterogens: LDA, BCL, BPH, U10, DIO, FE, SPN, PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v3yH (H:)
    fdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphg
    rgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghn
    kikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstr
    llpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrk
    s
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v3yL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaitff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v3yM (M:)
    aeyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hg