PDB entry 3v3x

View 3v3x on RCSB PDB site
Description: Nitroxide Spin Labels in Protein GB1: N8/K28 Double Mutant
Class: immune system
Keywords: domain-swapped dimer, nitroxide spin label, IMMUNE SYSTEM
Deposited on 2011-12-14, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (7)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d3v3xa1, d3v3xa2
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (7)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d3v3xb1, d3v3xb2
  • Chain 'C':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (7)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d3v3xc1, d3v3xc2
  • Chain 'D':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (7)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d3v3xd1, d3v3xd2
  • Heterogens: MTN, 2PE, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v3xA (A:)
    mqyklilcgktlkgettteavdaataecvfkqyandngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v3xB (B:)
    mqyklilcgktlkgettteavdaataecvfkqyandngvdgewtyddatktftvte
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v3xC (C:)
    mqyklilcgktlkgettteavdaataecvfkqyandngvdgewtyddatktftvte
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v3xD (D:)
    mqyklilcgktlkgettteavdaataecvfkqyandngvdgewtyddatktftvte