PDB entry 3v3w

View 3v3w on RCSB PDB site
Description: Crystal structure of an enolase from the soil bacterium Cellvibrio japonicus (TARGET EFI-502161) with bound MG and glycerol
Class: lyase
Keywords: Enolase, enzyme function initiative, EFI, LYASE
Deposited on 2011-12-14, released 2012-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.138
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Starvation sensing protein rspA
    Species: Cellvibrio japonicus [TaxId:498211]
    Gene: rspA, CJA_3069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3v3wa1, d3v3wa2
  • Heterogens: MG, GOL, NHE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v3wA (A:)
    mhhhhhhssgvdlgtenlyfqsmkivdakvivtcpgrnfvtlkivtdqgiygigdatlng
    reksvvsyledylipvligrdpqqiediwqffyrgaywrrgpvgmtalaaidvalwdika
    klanmplyqllggksrerilsythangkdldstleavrkakdkgykairvqcgipgiakt
    ygvstntksyepadadlpsvevwstekylnyipdvfaavrkefgpdihllhdvhhrltpi
    eaarlgkalepyhlfwmedavpaenqesfklirqhtttplavgevfnsihdcreliqnqw
    idyirttivhaggisqmrriadfaslfhvrtgfhgatdlspvcmgaalhfdywvpnfgiq
    ehmahseqmnavfphaytfndgyftpgekpghgvdideklaaqypykraclpvnrledgt
    lwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v3wA (A:)
    mkivdakvivtcpgrnfvtlkivtdqgiygigdatlngreksvvsyledylipvligrdp
    qqiediwqffyrgaywrrgpvgmtalaaidvalwdikaklanmplyqllggksrerilsy
    thangkdldstleavrkakdkgykairvqcgipgiaktygvsyepadadlpsvevwstek
    ylnyipdvfaavrkefgpdihllhdvhhrltpieaarlgkalepyhlfwmedavpaenqe
    sfklirqhtttplavgevfnsihdcreliqnqwidyirttivhaggisqmrriadfaslf
    hvrtgfhgatdlspvcmgaalhfdywvpnfgiqehmahseqmnavfphaytfndgyftpg
    ekpghgvdideklaaqypykraclpvnrledgtlwhw