PDB entry 3v3j

View 3v3j on RCSB PDB site
Description: Kinetic and structural studies of thermostabilized mutants of HCA II.
Class: lyase
Keywords: thermostabile, LYASE
Deposited on 2011-12-13, released 2012-06-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.184
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered mutation (6)
      • engineered mutation (61)
      • engineered mutation (66)
      • engineered mutation (99)
      • engineered mutation (222)
      • engineered mutation (238)
      • conflict (251)
    Domains in SCOPe 2.03: d3v3ja_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v3jA (A:)
    mshhwgfgkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nlghafqvefddsqdkavlkggpldgtyrliqfhfhwgshdgqgsehtvdkkkyaaelhl
    vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslttppllecvtwivlkepisvsseqvskfrklnfngegepeepm
    vdnwrpaqplkqrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v3jA (A:)
    hhwgfgkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnl
    ghafqvefddsqdkavlkggpldgtyrliqfhfhwgshdgqgsehtvdkkkyaaelhlvh
    wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvskfrklnfngegepeepmvd
    nwrpaqplkqrqikasfk