PDB entry 3v0a

View 3v0a on RCSB PDB site
Description: 2.7 angstrom crystal structure of BoNT/Ai in complex with NTNHA
Class: toxin
Keywords: Botulinum neurotoxin, toxin, Neurotoxin associated protein, Progenitor toxin complex, VHH bound interlocked complex, NTNHA
Deposited on 2011-12-07, released 2012-03-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.178
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BoNT/A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/a, boNT/A, bonta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7B8V4 (0-End)
      • engineered mutation (223)
      • engineered mutation (362)
      • engineered mutation (365)
      • conflict (1157)
  • Chain 'B':
    Compound: ntnh
    Species: Clostridium botulinum [TaxId:1491]
    Gene: ant, ntnh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45914 (2-1194)
      • expression tag (1195)
  • Chain 'C':
    Compound: Llama antibody F12
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V0A
    Domains in SCOPe 2.05: d3v0ac_
  • Heterogens: ZN, CA, SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3v0aC (C:)
    amaisdpnsqvqlvesggglvqpggslrlscaasgftlgsrymswvrqapgegfewvssi
    epsgtawdgdsakgrfttsrddakntlylqmsnlqpedtgvyycatgyrtdtripggswg
    qgtqvtvssepktpkpqtsgapvpypdplepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v0aC (C:)
    sqvqlvesggglvqpggslrlscaasgftlgsrymswvrqapgegfewvssiepsgtawd
    gdsakgrfttsrddakntlylqmsnlqpedtgvyycatgyrtdtripggswgqgtqvtv