PDB entry 3v03

View 3v03 on RCSB PDB site
Description: Crystal structure of Bovine Serum Albumin
Class: transport protein
Keywords: allergen, Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, carrier protein, TRANSPORT PROTEIN
Deposited on 2011-12-07, released 2012-01-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02769 (Start-582)
      • variant (189)
    Domains in SCOPe 2.04: d3v03a1, d3v03a2, d3v03a3
  • Chain 'B':
    Compound: serum albumin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02769 (Start-582)
      • variant (189)
    Domains in SCOPe 2.04: d3v03b1, d3v03b2, d3v03b3
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v03A (A:)
    dthkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadesha
    gcekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpn
    tlcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkv
    hkecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipen
    lppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecc
    akddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstp
    tlvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkate
    eqlktvmenfvafvdkccaaddkeacfavegpklvvstqtala
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v03A (A:)
    hkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshagc
    ekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpntl
    cdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpkie
    tmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkvhk
    ecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipenlp
    pltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleeccak
    ddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstptl
    vevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkccteslvn
    rrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkateeq
    lktvmenfvafvdkccaaddkeacfavegpklvvstqtala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v03B (B:)
    dthkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadesha
    gcekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpn
    tlcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkv
    hkecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipen
    lppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecc
    akddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstp
    tlvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkate
    eqlktvmenfvafvdkccaaddkeacfavegpklvvstqtala
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v03B (B:)
    hkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshagc
    ekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpntl
    cdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpkie
    tmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkvhk
    ecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipenlp
    pltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleeccak
    ddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstptl
    vevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkccteslvn
    rrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkateeq
    lktvmenfvafvdkccddkeacfavegpklvvstqtala