PDB entry 3uzo

View 3uzo on RCSB PDB site
Description: Crystal Structures of Branched-Chain Aminotransferase from Deinococcus radiodurans Complexes with alpha-Ketoisocaproate and L-Glutamate Suggest Its Radio-Resistance for Catalysis
Class: transferase
Keywords: BCAT, Amino-acid biosynthesis, Aminotransferase, Branched-chain amino acid biosynthesis, Pyridoxal phosphate, Transferase, L-Glutamate
Deposited on 2011-12-07, released 2012-12-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_1626
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uzoa_
  • Chain 'B':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_1626
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uzob_
  • Heterogens: PLP, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uzoA (A:)
    mrltilgmtahdsrpeqakkladidwstlgfsyirtdlrylahwkdgewdagtltednqi
    hlaegstalhygqqcfeglkayrcadgsinlfrpdqnaarmrmscrrllmpelsdeqfid
    aclqvvranehflppygtggslylrpfvigvgdnigvrtapefifsvfcvpvgpyfkggl
    tptnfitsdydraaphgtgaakvggnyaasllpgyeakkrdfadviyldpathttieeag
    aanffaitqdgqkfvtpqspsilpsitkysllwlaehrlgleveegdiridelgkfseag
    acgtaavitpiggiqhgddfhvfysesepgpvtrrlydelvgiqygdkeapegwivkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzoA (A:)
    idwstlgfsyirtdlrylahwkdgewdagtltednqihlaegstalhygqqcfeglkayr
    cadgsinlfrpdqnaarmrmscrrllmpelsdeqfidaclqvvranehflppygtggsly
    lrpfvigvgdnigvrtapefifsvfcvpvgpyfkggltptnfitsdydraaphgtgaakv
    ggnyaasllpgyeakkrdfadviyldpathttieeagaanffaitqdgqkfvtpqspsil
    psitkysllwlaehrlgleveegdiridelgkfseagacgtaavitpiggiqhgddfhvf
    ysesepgpvtrrlydelvgiqygdkeapegwivkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uzoB (B:)
    mrltilgmtahdsrpeqakkladidwstlgfsyirtdlrylahwkdgewdagtltednqi
    hlaegstalhygqqcfeglkayrcadgsinlfrpdqnaarmrmscrrllmpelsdeqfid
    aclqvvranehflppygtggslylrpfvigvgdnigvrtapefifsvfcvpvgpyfkggl
    tptnfitsdydraaphgtgaakvggnyaasllpgyeakkrdfadviyldpathttieeag
    aanffaitqdgqkfvtpqspsilpsitkysllwlaehrlgleveegdiridelgkfseag
    acgtaavitpiggiqhgddfhvfysesepgpvtrrlydelvgiqygdkeapegwivkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzoB (B:)
    idwstlgfsyirtdlrylahwkdgewdagtltednqihlaegstalhygqqcfeglkayr
    cadgsinlfrpdqnaarmrmscrrllmpelsdeqfidaclqvvranehflppygtggsly
    lrpfvigvgdnigvrtapefifsvfcvpvgpyfkggltptnfitsdydraaphgtgaakv
    ggnyaasllpgyeakkrdfadviyldpathttieeagaanffaitqdgqkfvtpqspsil
    psitkysllwlaehrlgleveegdiridelgkfseagacgtaavitpiggiqhgddfhvf
    ysesepgpvtrrlydelvgiqygdkeapegwivkv