PDB entry 3uze

View 3uze on RCSB PDB site
Description: Crystal structure of the dengue virus serotype 3 envelope protein domain III in complex with the variable domains of Mab 4E11
Class: immune system
Keywords: dengue antibody neutralization, IMMUNE SYSTEM
Deposited on 2011-12-07, released 2012-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.218
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Variable domains of murine anti-dengue Mab 4E11
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UZE
    Domains in SCOPe 2.07: d3uzea1, d3uzea2
  • Chain 'B':
    Compound: Variable domains of murine anti-dengue Mab 4E11
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UZE
    Domains in SCOPe 2.07: d3uzeb1, d3uzeb2
  • Chain 'C':
    Compound: envelope protein
    Species: Dengue virus 3 [TaxId:11069]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7TGD1 (Start-100)
      • expression tag (101-102)
    Domains in SCOPe 2.07: d3uzec1, d3uzec2
  • Chain 'D':
    Compound: envelope protein
    Species: Dengue virus 3 [TaxId:11069]
    Gene: E
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, GOL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uzeA (A:)
    evklleqsgaelvkpgasvrlsctasgfnikdtymswvkqrpeqglewigridpangdtk
    ydpkfqgkatitadtssntaylhlssltsgdtavyycsrgwegfaywgqgtlvtvsaggg
    gsggggsggggselvmtqtpaslavslgqratiscrasenvdrygnsfmhwyqqkagqpp
    klliyrasnlesgiparfsgsgsrtdftltinpveaddvatyfcqrsnevpwtfgggtkl
    eikrplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzeA (A:)
    vklleqsgaelvkpgasvrlsctasgfnikdtymswvkqrpeqglewigridpangdtky
    dpkfqgkatitadtssntaylhlssltsgdtavyycsrgwegfaywgqgtlvtvsaelvm
    tqtpaslavslgqratiscrasenvdrygnsfmhwyqqkagqppklliyrasnlesgipa
    rfsgsgsrtdftltinpveaddvatyfcqrsnevpwtfgggtkleikrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uzeB (B:)
    evklleqsgaelvkpgasvrlsctasgfnikdtymswvkqrpeqglewigridpangdtk
    ydpkfqgkatitadtssntaylhlssltsgdtavyycsrgwegfaywgqgtlvtvsaggg
    gsggggsggggselvmtqtpaslavslgqratiscrasenvdrygnsfmhwyqqkagqpp
    klliyrasnlesgiparfsgsgsrtdftltinpveaddvatyfcqrsnevpwtfgggtkl
    eikrplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzeB (B:)
    vklleqsgaelvkpgasvrlsctasgfnikdtymswvkqrpeqglewigridpangdtky
    dpkfqgkatitadtssntaylhlssltsgdtavyycsrgwegfaywgqgtlvtvsalvmt
    qtpaslavslgqratiscrasenvdrygnsfmhwyqqkagqppklliyrasnlesgipar
    fsgsgsrtdftltinpveaddvatyfcqrsnevpwtfgggtkleik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uzeC (C:)
    kgmsyamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlita
    npvvtkkeepvnieaeppfgesnivigigdkalkinwyrkgpfeddddkagwshpqfekg
    ggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzeC (C:)
    yamclntfvlkkevsehgtilikveykgedapckipfstedgqgkahngrlitanpvvtk
    kvnieaeppfgesnivigigdkalkinwyrkgpf
    

  • Chain 'D':
    No sequence available.