PDB entry 3uyn

View 3uyn on RCSB PDB site
Description: hca 3
Class: lyase
Keywords: proton shuttle, hca III, proton transfer, lyase
Deposited on 2011-12-06, released 2012-02-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.206
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07451 (Start-259)
      • engineered mutation (30)
      • engineered mutation (66)
      • engineered mutation (181)
      • engineered mutation (186)
    Domains in SCOPe 2.01: d3uyna_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uynA (A:)
    makewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktil
    nngktchvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhl
    vhwnpkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdp
    sslfpasrdywtyqgsfttppceecivwlllkepmtvssdqmaklrsllssaeneppvpl
    vsnwrppqpinnrvvrasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uynA (A:)
    akewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktiln
    ngktchvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlv
    hwnpkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdps
    slfpasrdywtyqgsfttppceecivwlllkepmtvssdqmaklrsllssaeneppvplv
    snwrppqpinnrvvrasfk