PDB entry 3uy6

View 3uy6 on RCSB PDB site
Description: BlaR1 sensor domain from Staphylococcus aureus with N439V mutation
Class: penicillin-binding protein
Keywords: ANTIBIOTIC SENSOR PROTEIN, penicillin-binding protein
Deposited on 2011-12-05, released 2012-02-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulatory protein blar1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: blaR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18357 (0-251)
      • engineered mutation (37-38)
      • engineered mutation (40)
      • engineered mutation (107)
    Domains in SCOPe 2.05: d3uy6a_
  • Chain 'B':
    Compound: regulatory protein blar1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: blaR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18357 (0-251)
      • engineered mutation (37-38)
      • engineered mutation (40)
      • engineered mutation (107)
    Domains in SCOPe 2.05: d3uy6b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uy6A (A:)
    qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
    kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvvwyferisdqipk
    nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
    sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
    sekilkemgvln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uy6B (B:)
    qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
    kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvvwyferisdqipk
    nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
    sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
    sekilkemgvln