PDB entry 3uxo

View 3uxo on RCSB PDB site
Description: Crystal Structure of Rat DNA Polymerase Beta Mutator I260Q Apoenzyme
Class: transferase, lyase
Keywords: DNA polymerase beta, BER, TRANSFERASE, LYASE
Deposited on 2011-12-05, released 2012-12-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.26
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: POLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06766
      • engineered mutation (259)
    Domains in SCOPe 2.05: d3uxoa1, d3uxoa2, d3uxoa3
  • Chain 'B':
    Compound: DNA polymerase beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: POLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06766
      • engineered mutation (259)
    Domains in SCOPe 2.05: d3uxob1, d3uxob2, d3uxob3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uxoA (A:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlqpkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uxoA (A:)
    tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
    aekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkne
    dklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessg
    dmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendene
    yphrridirlqpkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvage
    plpvdseqdifdyiqwryrepkdrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uxoB (B:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlqpkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uxoB (B:)
    tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
    aekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkne
    dklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessg
    dmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendene
    yphrridirlqpkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvage
    plpvdseqdifdyiqwryrepkdrs