PDB entry 3uwo

View 3uwo on RCSB PDB site
Description: Structure Guided Development of Novel Thymidine Mimetics targeting Pseudomonas aeruginosa Thymidylate Kinase: from Hit to Lead Generation
Class: transferase/transferase inhibitor
Keywords: Thymidylate kinase, kinase, thymidine triphosphate, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-12-02, released 2012-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uwoa_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uwob_
  • Heterogens: 0DJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uwoA (A:)
    glvprgshmtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirel
    llapsdepmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglp
    eariaalesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylq
    raaqaperyqvldaglplaevqagldrllpnllerlnggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uwoA (A:)
    glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
    adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
    vqgdlrpdltlvfdlpvrldrfeqedrrffeavrqtylqraaqaperyqvldaglplaev
    qagldrllpnller
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uwoB (B:)
    glvprgshmtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirel
    llapsdepmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglp
    eariaalesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylq
    raaqaperyqvldaglplaevqagldrllpnllerlnggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uwoB (B:)
    glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
    adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
    vqgdlrpdltlvfdlpvldrfeqedrrffeavrqtylqraaqaperyqvldaglplaevq
    agldrllpnll