PDB entry 3uw8

View 3uw8 on RCSB PDB site
Description: Crystal Structure Analysis of the Ser305Thr Variants of KatG from Haloarcula marismortui
Class: Oxidoreductase
Keywords: CATALASE-PEROXIDASE, Oxidoreductase
Deposited on 2011-12-01, released 2012-12-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.257
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase 2
    Species: Haloarcula marismortui [TaxId:272569]
    Gene: katG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59651 (Start-730)
      • engineered mutation (304)
    Domains in SCOPe 2.05: d3uw8a1, d3uw8a2
  • Chain 'B':
    Compound: Catalase-peroxidase 2
    Species: Haloarcula marismortui [TaxId:272569]
    Gene: katG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59651 (Start-730)
      • engineered mutation (304)
    Domains in SCOPe 2.05: d3uw8b1, d3uw8b2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uw8A (A:)
    maetpnsdmsgatggrskrpksnqdwwpsklnleildqnardvgpveddfdyaeefqkld
    leavksdleelmtssqdwwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapi
    nswpdnanldkarrlllpikqkygqkiswadlmilagnvaiesmgfktfgyaggredafe
    edkavnwgpedefetqerfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqt
    fdrmamndketaaliagghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskgg
    emittgiegpwtqsptewdmgyinnlldyewepekgpggawqwapkseelknsvpdahdp
    dekqtpmmlttdialkrdpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgp
    evpdeemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkr
    ggangarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggna
    aveqaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevl
    vdnadllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewep
    aadsehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtws
    kvmkldrfdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uw8A (A:)
    krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
    wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
    pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
    rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
    ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemittgiegpwtqspte
    wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
    dpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgpevpdeemiwqdplpdad
    ydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrggangarlrlepqknwe
    vnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaaveqaaanagydveipf
    epgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdnadllnltaseltal
    iggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaadsehrykgldrdtge
    vkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvmkldrfdle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uw8B (B:)
    maetpnsdmsgatggrskrpksnqdwwpsklnleildqnardvgpveddfdyaeefqkld
    leavksdleelmtssqdwwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapi
    nswpdnanldkarrlllpikqkygqkiswadlmilagnvaiesmgfktfgyaggredafe
    edkavnwgpedefetqerfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqt
    fdrmamndketaaliagghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskgg
    emittgiegpwtqsptewdmgyinnlldyewepekgpggawqwapkseelknsvpdahdp
    dekqtpmmlttdialkrdpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgp
    evpdeemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkr
    ggangarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggna
    aveqaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevl
    vdnadllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewep
    aadsehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtws
    kvmkldrfdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uw8B (B:)
    krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
    wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
    pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
    rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
    ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemittgiegpwtqspte
    wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
    dpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgpevpdeemiwqdplpdad
    ydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrggangarlrlepqknwe
    vnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaaveqaaanagydveipf
    epgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdnadllnltaseltal
    iggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaadsehrykgldrdtge
    vkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvmkldrfdle