PDB entry 3uvv

View 3uvv on RCSB PDB site
Description: Crystal Structure of the ligand binding domains of the thyroid receptor:retinoid X receptor complexed with 3,3',5 triiodo-L-thyronine and 9-cis retinoic acid
Class: hormone receptor/hormone receptor
Keywords: TR-RXR heterodimer, allostery, alpha helical sandwich, transactivation, HORMONE RECEPTOR-HORMONE RECEPTOR complex
Deposited on 2011-11-30, released 2012-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.203
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thyroid hormone receptor alpha
    Species: Gallus gallus [TaxId:9031]
    Gene: THRA, NR1A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04625 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.06: d3uvva1, d3uvva2
  • Chain 'B':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uvvb_
  • Heterogens: T3, REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uvvA (A:)
    gshemikslqhrpspsaeewelihvvteahrstnaqgshwkqkrkflpedigqspmasmp
    dgdkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraav
    rydpesetltlsgemavkreqlkngglgvvsdaifdlgkslsafnlddtevallqavllm
    ssdrtglicvdkiekcqetyllafehyinyrkhniphfwpkllmkvtdlrmigachasrf
    lhmkvecptelfpplflevfedqev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uvvA (A:)
    emikslqhrpspsaeewelihvvteahrstnaqgshwkqkrkflpedipddkvdleafse
    ftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavrydpesetltls
    gemavkreqlkngglgvvsdaifdlgkslsafnlddtevallqavllmssdrtglicvdk
    iekcqetyllafehyinyrkhniphfwpkllmkvtdlrmigachasrflhmkvecptelf
    pplflevfed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uvvB (B:)
    mkkgsanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlv
    ewakriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsa
    gvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasl
    eayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphq
    mtmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uvvB (B:)
    nedmpverileaelavepktpndpvtnicqaadkqlftlvewakriphfselplddqvil
    lragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdm
    qmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklll
    rlpalrsiglkclehlfffkligdtpidtflmemleap