PDB entry 3ur8

View 3ur8 on RCSB PDB site
Description: Lower-density crystal structure of potato endo-1,3-beta-glucanase
Class: hydrolase
Keywords: glucoside hydrolase, GH17 family, pathogenesis-related class-2 protein (PR-2), TIM Barrel, Glycoside Hydrolase, Carbohydrate/Sugar Binding, HYDROLASE
Deposited on 2011-11-21, released 2012-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: 0.143
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucan endo-1,3-beta-D-glucosidase
    Species: Solanum tuberosum [TaxId:4113]
    Gene: gluB20-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70C53 (0-314)
      • expression tag (315-320)
    Domains in SCOPe 2.06: d3ur8a1, d3ur8a2
  • Chain 'B':
    Compound: Glucan endo-1,3-beta-D-glucosidase
    Species: Solanum tuberosum [TaxId:4113]
    Gene: gluB20-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70C53 (0-314)
      • expression tag (315-320)
    Domains in SCOPe 2.06: d3ur8b1, d3ur8b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ur8A (A:)
    qpigvcygkiannlpsdqdviklynannikkmriyyphtnvfnalkgsnieiildvpnqd
    lealanpsnangwvqdnirnhfpdvkfkyiavgnevdpgresgkyarfvgpameniynal
    ssaglqnqikvststysglltntypprdsifreeyksfinpiigflarhnlpllaniypy
    fghidntnavplsyalfnqqrrndtgyqnlfdalvdsmyfateklggqnieiivsesgwp
    seghpaatlknartyytnlinhvkrgagtpkkpgktietylfamfdenekkgeasekhfg
    lfnpdqrpkyqlnfnlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ur8A (A:)
    qpigvcygkiannlpsdqdviklynannikkmriyyphtnvfnalkgsnieiildvpnqd
    lealanpsnangwvqdnirnhfpdvkfkyiavgnevdpgresgkyarfvgpameniynal
    ssaglqnqikvststysglltntypprdsifreeyksfinpiigflarhnlpllaniypy
    fghidntnavplsyalfnqqrrndtgyqnlfdalvdsmyfateklggqnieiivsesgwp
    seghpaatlknartyytnlinhvkrgagtpkkpgktietylfamfdenekkgeasekhfg
    lfnpdqrpkyqlnfnlnhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ur8B (B:)
    qpigvcygkiannlpsdqdviklynannikkmriyyphtnvfnalkgsnieiildvpnqd
    lealanpsnangwvqdnirnhfpdvkfkyiavgnevdpgresgkyarfvgpameniynal
    ssaglqnqikvststysglltntypprdsifreeyksfinpiigflarhnlpllaniypy
    fghidntnavplsyalfnqqrrndtgyqnlfdalvdsmyfateklggqnieiivsesgwp
    seghpaatlknartyytnlinhvkrgagtpkkpgktietylfamfdenekkgeasekhfg
    lfnpdqrpkyqlnfnlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ur8B (B:)
    qpigvcygkiannlpsdqdviklynannikkmriyyphtnvfnalkgsnieiildvpnqd
    lealanpsnangwvqdnirnhfpdvkfkyiavgnevdpgresgkyarfvgpameniynal
    ssaglqnqikvststysglltntypprdsifreeyksfinpiigflarhnlpllaniypy
    fghidntnavplsyalfnqtgyqnlfdalvdsmyfateklggqnieiivsesgwpseghp
    aatlknartyytnlinhvkrgagtpkkpgktietylfamfdenekkgeasekhfglfnpd
    qrpkyqlnfnlnhhhh