PDB entry 3uqg

View 3uqg on RCSB PDB site
Description: c-SRC kinase domain in complex with bumpless BKI analog UW1243
Class: transferase/transferase inhibitor
Keywords: tyrosine protein kinase, ATP-binding, kinase domain, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-11-20, released 2012-03-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uqga_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uqgb_
  • Heterogens: B5A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uqgA (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uqgA (A:)
    daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
    ermnyvhrdlraanilvgenlvckvadfglarlipikwtapeaalygrftiksdvwsfgi
    lltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfe
    ylqafledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uqgB (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uqgB (B:)
    akdaweipreslrlevklgqevwmgtwngttrvaiktlkspeaflqeaqvmkklrheklv
    qlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyv
    hrdlraanilvgenlvckvadfglarlipikwtapeaalygrftiksdvwsfgilltelt
    tkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafl
    edyftstepqyqpgenl