PDB entry 3uq2

View 3uq2 on RCSB PDB site
Description: Crystal structure of the post-catalytic product complex of polymerase lambda with an rCMP inserted opposite a templating G and dAMP inserted opposite a templating T at the primer terminus.
Class: transferase, lyase/DNA
Keywords: DNA polymerase lambda, ribonucleotide incorporation, Protein Conformation, TRANSFERASE, LYASE-DNA complex
Deposited on 2011-11-18, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-328)
      • see remark 999 (221-224)
      • engineered mutation (296)
    Domains in SCOPe 2.07: d3uq2a1, d3uq2a2, d3uq2a3
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'P':
    Compound: 5'-d(*cp*ap*gp*tp*ap)-r(p*cp*a)-3'
  • Chain 'T':
    Compound: 5'-d(*cp*gp*gp*cp*tp*gp*tp*ap*cp*tp*g)-3'
  • Heterogens: PPV, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uq2A (A:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrh
    rrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgakvg
    pgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uq2A (A:)
    nlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmaek
    iieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttq
    qaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvli
    thpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvpys
    efacallyftgsahfnrsmralaktkgmslsehalstavvrnthgakvgpgrvlptptek
    dvfrllglpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.