PDB entry 3uq0

View 3uq0 on RCSB PDB site
Description: Crystal structure of the post-catalytic product complex of polymerase lambda with an rAMP at the primer terminus.
Class: transferase, lyase/DNA
Keywords: DNA polymerase lambda, ribonucleotide incorporation, Protein Conformation, TRANSFERASE, LYASE-DNA complex
Deposited on 2011-11-18, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-328)
      • see remark 999 (221-224)
    Domains in SCOPe 2.07: d3uq0a1, d3uq0a2, d3uq0a3
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'P':
    Compound: 5'-d(*cp*ap*gp*tp*ap*cp)-r(p*a)-3'
  • Chain 'T':
    Compound: 5'-d(*cp*gp*gp*cp*tp*gp*tp*ap*cp*tp*g)-3'
  • Heterogens: NA, SO4, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uq0A (A:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrh
    rrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvg
    pgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uq0A (A:)
    nhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrma
    ekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslt
    tqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdv
    lithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvp
    ysefacallyftgsahfnrsmralaktkgmslsehalstavvgpgrvlptptekdvfrll
    glpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.