PDB entry 3upq

View 3upq on RCSB PDB site
Description: Crystal structure of the pre-catalytic ternary complex of polymerase lambda with an rATP analog opposite a templating T.
Class: transferase, lyase/DNA
Keywords: DNA, Polymerase, DNA polymerase lambda, ribonucleotide incorporation, TRANSFERASE, LYASE-DNA complex
Deposited on 2011-11-18, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.209
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-328)
      • see remark 999 (221-224)
    Domains in SCOPe 2.07: d3upqa1, d3upqa2, d3upqa3
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'P':
    Compound: 5'-d(*cp*ap*gp*tp*ap*c)-3'
  • Chain 'T':
    Compound: 5'-d(*cp*gp*gp*cp*tp*gp*tp*ap*cp*tp*g)-3'
  • Heterogens: ZAN, MN, NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3upqA (A:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrh
    rrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvg
    pgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3upqA (A:)
    hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
    kiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasltt
    qqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvl
    ithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvpy
    sefacallyftgsahfnrsmralaktkgmslsehalstavgrvlptptekdvfrllglpy
    repaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.