PDB entry 3und

View 3und on RCSB PDB site
Description: Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia pseudomallei
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2011-11-15, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.168
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JP68 (4-284)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d3unda1, d3unda2
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JP68 (4-284)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d3undb1, d3undb2
  • Chain 'C':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JP68 (4-284)
      • expression tag (3)
    Domains in SCOPe 2.07: d3undc1, d3undc2
  • Chain 'D':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JP68 (4-284)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d3undd1, d3undd2
  • Heterogens: A5P, PEP, KD0, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3undA (A:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3undA (A:)
    gsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdk
    anrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflar
    qtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvd
    mlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglflea
    hpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3undB (B:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3undB (B:)
    pgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfd
    kanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafla
    rqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvv
    dmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfle
    ahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3undC (C:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3undC (C:)
    smnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdka
    nrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarq
    tdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdm
    lgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfleah
    pdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3undD (D:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3undD (D:)
    pgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfd
    kanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafla
    rqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvv
    dmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfle
    ahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir