PDB entry 3unb

View 3unb on RCSB PDB site
Description: Mouse constitutive 20S proteasome in complex with PR-957
Class: hydrolase/hydrolase inhibitor
Keywords: 20S proteasome comprises 28 subunits; each subunit adopts the fold of an antiparallel beta-sheet flanked by helices, Protease, Regulatory complexes, Covalent binding of PR-957 to all active sites, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-11-15, released 2012-02-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.232
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome subunit beta type-5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unb1_
  • Chain '2':
    Compound: Proteasome subunit beta type-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unb2_
  • Chain '3':
    Compound: Proteasome subunit beta type-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unb3_
  • Chain '4':
    Compound: Proteasome subunit beta type-6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unb4_
  • Chain 'A':
    Compound: Proteasome subunit alpha type-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unba_
  • Chain 'B':
    Compound: Proteasome subunit alpha type-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Proteasome subunit alpha type-7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z2U0
      • conflict (45)
  • Chain 'D':
    Compound: Proteasome subunit alpha type-5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbd_
  • Chain 'E':
    Compound: Proteasome subunit alpha type-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbe_
  • Chain 'F':
    Compound: Proteasome subunit alpha type-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbf_
  • Chain 'G':
    Compound: Proteasome subunit alpha type-6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbg_
  • Chain 'H':
    Compound: Proteasome subunit beta type-7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbh_
  • Chain 'I':
    Compound: Proteasome subunit beta type-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbi_
  • Chain 'J':
    Compound: Proteasome subunit beta type-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbj_
  • Chain 'K':
    Compound: Proteasome subunit beta type-5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbk_
  • Chain 'L':
    Compound: Proteasome subunit beta type-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbl_
  • Chain 'M':
    Compound: Proteasome subunit beta type-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbm_
  • Chain 'N':
    Compound: Proteasome subunit beta type-6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbn_
  • Chain 'O':
    Compound: Proteasome subunit alpha type-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbo_
  • Chain 'P':
    Compound: Proteasome subunit alpha type-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Proteasome subunit alpha type-7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z2U0
      • conflict (45)
  • Chain 'R':
    Compound: Proteasome subunit alpha type-5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbr_
  • Chain 'S':
    Compound: Proteasome subunit alpha type-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbs_
  • Chain 'T':
    Compound: Proteasome subunit alpha type-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbt_
  • Chain 'U':
    Compound: Proteasome subunit alpha type-6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbu_
  • Chain 'V':
    Compound: Proteasome subunit beta type-7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbv_
  • Chain 'W':
    Compound: Proteasome subunit beta type-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbw_
  • Chain 'X':
    Compound: Proteasome subunit beta type-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbx_
  • Chain 'Y':
    Compound: Proteasome subunit beta type-5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unby_
  • Chain 'Z':
    Compound: Proteasome subunit beta type-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbz_
  • Chain 'a':
    Compound: Proteasome subunit beta type-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome subunit beta type-6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbb_
  • Chain 'c':
    Compound: Proteasome subunit alpha type-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbc_
  • Chain 'd':
    Compound: Proteasome subunit alpha type-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Proteasome subunit alpha type-7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z2U0
      • conflict (45)
  • Chain 'f':
    Compound: Proteasome subunit alpha type-5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Proteasome subunit alpha type-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Proteasome subunit alpha type-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Proteasome subunit alpha type-6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Proteasome subunit beta type-7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Proteasome subunit beta type-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Proteasome subunit beta type-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Proteasome subunit beta type-5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Proteasome subunit beta type-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Proteasome subunit beta type-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: Proteasome subunit beta type-6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbp_
  • Chain 'q':
    Compound: Proteasome subunit alpha type-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3unbq_
  • Chain 'r':
    Compound: Proteasome subunit alpha type-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: Proteasome subunit alpha type-7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z2U0
      • conflict (45)
  • Chain 't':
    Compound: Proteasome subunit alpha type-5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Proteasome subunit alpha type-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: Proteasome subunit alpha type-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'w':
    Compound: Proteasome subunit alpha type-6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Proteasome subunit beta type-7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'y':
    Compound: Proteasome subunit beta type-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: Proteasome subunit beta type-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 04C, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3unb1 (1:)
    tttlafkflhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgtafsvgsgsvyaygvmdrgysydlkveeaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhdkyssvsvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unb1 (1:)
    tttlafkflhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgtafsvgsgsvyaygvmdrgysydlkveeaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhdkyss
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3unb2 (2:)
    rfspyafnggtvlaiagedfsivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvpltldramrlvkdvfi
    saaerdvytgdalricivtkegireetvplrkd
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >3unb3 (3:)
    tqnpmvtgtsvlgvkfdggvviaadmlgsygslarfrnisrimrvndstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqtearelvercmrvlyyrd
    arsynrfqiatvtekgveiegplsaqtnwdiahmisgfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unb3 (3:)
    tqnpmvtgtsvlgvkfdggvviaadmlgsygslarfrnisrimrvndstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqtearelvercmrvlyyrd
    arsynrfqiatvtekgveiegplsaqtnwdiahmis
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >3unb4 (4:)
    ttimavqfnggvvlgadsrtttgsyianrvtdkltpihdhifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkdeclqftanalalamerdgssggvirlaaiq
    esgverqvllgdqipkftiatlppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unb4 (4:)
    ttimavqfnggvvlgadsrtttgsyianrvtdkltpihdhifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkdeclqftanalalamerdgssggvirlaaiq
    esgverqvllgdqipkftiatl
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3unbA (A:)
    makrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyder
    svhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqe
    ytqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryne
    dleledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbA (A:)
    akrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders
    vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey
    tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned
    leledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaa
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3unbD (D:)
    mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
    pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
    lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
    lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbD (D:)
    drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
    eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
    dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks
    mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3unbE (E:)
    mfrnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahq
    kkilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqipt
    qrygrrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefm
    ecnldelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspfldgleerp
    qrkaqpsqaaeepaekadepmeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbE (E:)
    nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
    lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
    grrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefmecn
    ldelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspfldgleerpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3unbF (F:)
    mssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklye
    egsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyv
    haytlysavrpfgcsfmlgsysandgaqlymidpsgvsygywgcaigkarqaakteiekl
    qmkemtcrdvvkevakiiyivhdevkdkafelelswvgeltkgrheivpkdireeaekya
    keslkeedesdddnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbF (F:)
    ssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyee
    gsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvh
    aytlysavrpfgcsfmlgsysandgaqlymidpsgvsygywgcaigkarqaakteieklq
    mkemtcrdvvkevakiiyivhdevkdkafelelswvgeltkgrheivpkdireeaekyak
    eslk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3unbG (G:)
    msrgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkl
    ldsstvthlfkitesigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriad
    isqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsfle
    kkvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlv
    alaerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbG (G:)
    srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkll
    dsstvthlfkitesigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
    sqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflek
    kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
    lae
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3unbH (H:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslttgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeakklvseaiaagifndlgsgsnidlcvisk
    skldflrpfsvpnkkgtrlgryrcekgttavltekvtpleievleetvqtmdts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbH (H:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslttgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeakklvseaiaagifndlgsgsnidlcvisk
    skldflrpfsvpnkkgtrlgryrcekgttavltekvtple
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3unbI (I:)
    msimsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdv
    qtvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpf
    icsldligcpmvtddfvvsgtcseqmygmceslwepnmdpehlfetisqamlnavdrdav
    sgmgvivhviekdkittrtlkarmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbI (I:)
    simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
    tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
    csldligcpmvtddfvvsgtcseqmygmceslwepnmdpehlfetisqamlnavdrdavs
    gmgvivhviekdkittrtlkarmd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3unbJ (J:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    rvidkdgihnleniafpkrds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbJ (J:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    rvidkdgihnleniaf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3unbK (K:)
    tttlafkflhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgtafsvgsgsvyaygvmdrgysydlkveeaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhdkyssvsvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbK (K:)
    tttlafkflhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgtafsvgsgsvyaygvmdrgysydlkveeaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhdkyss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3unbL (L:)
    rfspyafnggtvlaiagedfsivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvpltldramrlvkdvfi
    saaerdvytgdalricivtkegireetvplrkd
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3unbM (M:)
    tqnpmvtgtsvlgvkfdggvviaadmlgsygslarfrnisrimrvndstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqtearelvercmrvlyyrd
    arsynrfqiatvtekgveiegplsaqtnwdiahmisgfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbM (M:)
    tqnpmvtgtsvlgvkfdggvviaadmlgsygslarfrnisrimrvndstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqtearelvercmrvlyyrd
    arsynrfqiatvtekgveiegplsaqtnwdiahmis
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3unbN (N:)
    ttimavqfnggvvlgadsrtttgsyianrvtdkltpihdhifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkdeclqftanalalamerdgssggvirlaaiq
    esgverqvllgdqipkftiatlppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbN (N:)
    ttimavqfnggvvlgadsrtttgsyianrvtdkltpihdhifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkdeclqftanalalamerdgssggvirlaaiq
    esgverqvllgdqipkftiatl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3unbO (O:)
    makrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyder
    svhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqe
    ytqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryne
    dleledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbO (O:)
    akrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders
    vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey
    tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned
    leledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaa
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3unbR (R:)
    mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
    pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
    lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
    lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbR (R:)
    drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
    eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
    dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks
    mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3unbS (S:)
    mfrnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahq
    kkilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqipt
    qrygrrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefm
    ecnldelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspfldgleerp
    qrkaqpsqaaeepaekadepmeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbS (S:)
    nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
    lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
    grrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefmecn
    ldelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspfldgleerpq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3unbT (T:)
    mssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklye
    egsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyv
    haytlysavrpfgcsfmlgsysandgaqlymidpsgvsygywgcaigkarqaakteiekl
    qmkemtcrdvvkevakiiyivhdevkdkafelelswvgeltkgrheivpkdireeaekya
    keslkeedesdddnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbT (T:)
    ssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyee
    gsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvh
    aytlysavrpfgcsfmlgsysandgaqlymidpsgvsygywgcaigkarqaakteieklq
    mkemtcrdvvkevakiiyivhdevkdkafelelswvgeltkgrheivpkdireeaekyak
    eslk
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3unbU (U:)
    msrgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkl
    ldsstvthlfkitesigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriad
    isqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsfle
    kkvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlv
    alaerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbU (U:)
    srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkll
    dsstvthlfkitesigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
    sqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflek
    kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
    lae
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3unbV (V:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslttgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeakklvseaiaagifndlgsgsnidlcvisk
    skldflrpfsvpnkkgtrlgryrcekgttavltekvtpleievleetvqtmdts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbV (V:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslttgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeakklvseaiaagifndlgsgsnidlcvisk
    skldflrpfsvpnkkgtrlgryrcekgttavltekvtple
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3unbW (W:)
    msimsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdv
    qtvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpf
    icsldligcpmvtddfvvsgtcseqmygmceslwepnmdpehlfetisqamlnavdrdav
    sgmgvivhviekdkittrtlkarmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbW (W:)
    simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
    tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
    csldligcpmvtddfvvsgtcseqmygmceslwepnmdpehlfetisqamlnavdrdavs
    gmgvivhviekdkittrtlkarmd
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3unbX (X:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    rvidkdgihnleniafpkrds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbX (X:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    rvidkdgihnleniaf
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3unbY (Y:)
    tttlafkflhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgtafsvgsgsvyaygvmdrgysydlkveeaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhdkyssvsvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbY (Y:)
    tttlafkflhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgtafsvgsgsvyaygvmdrgysydlkveeaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhdkyss
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3unbZ (Z:)
    rfspyafnggtvlaiagedfsivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvpltldramrlvkdvfi
    saaerdvytgdalricivtkegireetvplrkd
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    Sequence, based on SEQRES records: (download)
    >3unbb (b:)
    ttimavqfnggvvlgadsrtttgsyianrvtdkltpihdhifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkdeclqftanalalamerdgssggvirlaaiq
    esgverqvllgdqipkftiatlppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbb (b:)
    ttimavqfnggvvlgadsrtttgsyianrvtdkltpihdhifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkdeclqftanalalamerdgssggvirlaaiq
    esgverqvllgdqipkftiatl
    

  • Chain 'c':
    Sequence, based on SEQRES records: (download)
    >3unbc (c:)
    makrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyder
    svhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqe
    ytqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryne
    dleledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbc (c:)
    akrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders
    vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey
    tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned
    leledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaa
    

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'p':
    Sequence, based on SEQRES records: (download)
    >3unbp (p:)
    ttimavqfnggvvlgadsrtttgsyianrvtdkltpihdhifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkdeclqftanalalamerdgssggvirlaaiq
    esgverqvllgdqipkftiatlppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbp (p:)
    ttimavqfnggvvlgadsrtttgsyianrvtdkltpihdhifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkdeclqftanalalamerdgssggvirlaaiq
    esgverqvllgdqipkftiatl
    

  • Chain 'q':
    Sequence, based on SEQRES records: (download)
    >3unbq (q:)
    makrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyder
    svhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqe
    ytqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryne
    dleledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3unbq (q:)
    akrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders
    vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey
    tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned
    leledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaa
    

  • Chain 'r':
    No sequence available.

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    No sequence available.

  • Chain 'w':
    No sequence available.

  • Chain 'x':
    No sequence available.

  • Chain 'y':
    No sequence available.

  • Chain 'z':
    No sequence available.