PDB entry 3umt

View 3umt on RCSB PDB site
Description: scFv12, Anti-BclA antibody single chain variable fragment
Class: immune system
Keywords: scFv, stability engineering, Anthrax, Anti-BclA antibody, Immunoglobulin fold (VH and VL domains), Antibody, IMMUNE SYSTEM
Deposited on 2011-11-14, released 2012-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scFv heavy chain and light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UMT
    Domains in SCOPe 2.06: d3umta1, d3umta2
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3umtA (A:)
    maqvqlqqsglelvkpgasvkiscktsgytfteytmhwvkqshgkslewigginpnnggt
    synqkfkgkailtvdkssstaylelrsltsedsavyycarddrypawfaywgqgttvtvs
    sggggsggggsggggstdiqltqspsslsaslgervsitcrasqdigsnlnwlqqkpdgt
    ikrliyatssldsgvpkrfsgsrsgsdysltisslesedfvdyyclqyasspptfgggtk
    leikraaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umtA (A:)
    qvqlqqsglelvkpgasvkiscktsgytfteytmhwvkqshgkslewigginpnnggtsy
    nqkfkgkailtvdkssstaylelrsltsedsavyycarddrypawfaywgqgttvtvsst
    diqltqspsslsaslgervsitcrasqdigsnlnwlqqkpdgtikrliyatssldsgvpk
    rfsgsrsgsdysltisslesedfvdyyclqyasspptfgggtkleik