PDB entry 3umf

View 3umf on RCSB PDB site
Description: Schistosoma mansoni adenylate kinase
Class: transferase
Keywords: Rossmann fold, TRANSFERASE
Deposited on 2011-11-13, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_071390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3umfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3umfA (A:)
    mgsshhhhhhssglvprgshmtdqklakakvifvlggpgsgkgtqceklvqkfhfnhlss
    gdllraevqsgspkgkelkammergelvplevvlallkeamiklvdknchflidgyprel
    dqgikfekevcpclcvinfdvseevmrkrllkraetsnrvddneetivkrfrtfneltkp
    viehykqqnkvitidasgtvdaifdkvnhelqkfgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umfA (A:)
    qklakakvifvlggpgsgkgtqceklvqkfhfnhlssgdllraevqsgspkgkelkamme
    rgelvplevvlallkeamiklvdknchflidgypreldqgikfekevcpclcvinfdvse
    evmrkrllkrvddneetivkrfrtfneltkpviehykqqnkvitidasgtvdaifdkvnh
    elqkfgvk