PDB entry 3ukt

View 3ukt on RCSB PDB site
Description: Structure of the C-linker/CNBHD of zELK channels in P1 21 1 space group
Class: transport protein, membrane protein
Keywords: KCNH, ELK, ERG, EAG, CNBD, CNBHD, C-linker, Ion Channel, cyclic nucleotide, cyclic nucleotide-binding domain, ion transport, TRANSPORT PROTEIN, MEMBRANE PROTEIN
Deposited on 2011-11-09, released 2012-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Novel protein similar to vertebrate potassium voltage-gated channel, subfamily H (Eag-related) family
    Species: Danio rerio [TaxId:7955]
    Gene: CH211-11O22.2-001, ELK, KCNH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ukta_
  • Chain 'B':
    Compound: Novel protein similar to vertebrate potassium voltage-gated channel, subfamily H (Eag-related) family
    Species: Danio rerio [TaxId:7955]
    Gene: CH211-11O22.2-001, ELK, KCNH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uktb_
  • Chain 'C':
    Compound: Novel protein similar to vertebrate potassium voltage-gated channel, subfamily H (Eag-related) family
    Species: Danio rerio [TaxId:7955]
    Gene: CH211-11O22.2-001, ELK, KCNH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uktc_
  • Chain 'D':
    Compound: Novel protein similar to vertebrate potassium voltage-gated channel, subfamily H (Eag-related) family
    Species: Danio rerio [TaxId:7955]
    Gene: CH211-11O22.2-001, ELK, KCNH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uktd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uktA (A:)
    gamdqrmysrrslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkd
    fpdelradiamhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiy
    fvcsgsmevlkdntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglre
    vlrlypeyaqkfvseiqhdltynlregsgadl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uktA (A:)
    rslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradia
    mhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmevl
    kdntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlrlypeyaq
    kfvseiqhdltynlre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uktB (B:)
    gamdqrmysrrslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkd
    fpdelradiamhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiy
    fvcsgsmevlkdntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglre
    vlrlypeyaqkfvseiqhdltynlregsgadl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uktB (B:)
    rrslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradi
    amhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmev
    lkdntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlrlypeya
    qkfvseiqhdltynlreg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uktC (C:)
    gamdqrmysrrslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkd
    fpdelradiamhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiy
    fvcsgsmevlkdntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglre
    vlrlypeyaqkfvseiqhdltynlregsgadl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uktC (C:)
    rslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradia
    mhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmevl
    kdntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlrlypeyaq
    kfvseiqhdltynlre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uktD (D:)
    gamdqrmysrrslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkd
    fpdelradiamhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiy
    fvcsgsmevlkdntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglre
    vlrlypeyaqkfvseiqhdltynlregsgadl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uktD (D:)
    lyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradiamh
    lnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmevlkd
    ntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlhdltynl